powered by:
Protein Alignment san and AT1G03650
DIOPT Version :9
Sequence 1: | NP_524779.1 |
Gene: | san / 44724 |
FlyBaseID: | FBgn0024188 |
Length: | 184 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_171861.1 |
Gene: | AT1G03650 / 839021 |
AraportID: | AT1G03650 |
Length: | 158 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 15/56 - (26%) |
Similarity: | 24/56 - (42%) |
Gaps: | 1/56 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 RRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYY 139
||.|.|..:....::.. :......:.|||......|:..|||.||::....:.||
plant 87 RRQGHGEALLRAAIDKC-RSRKVQRVSLHVDPTRTSAVNLYKKLGFQVDCLVKSYY 141
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0456 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1536763at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002246 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.