DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and AT1G03650

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_171861.1 Gene:AT1G03650 / 839021 AraportID:AT1G03650 Length:158 Species:Arabidopsis thaliana


Alignment Length:56 Identity:15/56 - (26%)
Similarity:24/56 - (42%) Gaps:1/56 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYY 139
            ||.|.|..:....::.. :......:.|||......|:..|||.||::....:.||
plant    87 RRQGHGEALLRAAIDKC-RSRKVQRVSLHVDPTRTSAVNLYKKLGFQVDCLVKSYY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 15/56 (27%)
Acetyltransf_1 50..130 CDD:278980 12/45 (27%)
AT1G03650NP_171861.1 rimI 20..150 CDD:273701 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536763at2759
OrthoFinder 1 1.000 - - FOG0002246
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.