DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and AT5G11340

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_196695.1 Gene:AT5G11340 / 831005 AraportID:AT5G11340 Length:164 Species:Arabidopsis thaliana


Alignment Length:157 Identity:83/157 - (52%)
Similarity:108/157 - (68%) Gaps:2/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRIDNTEN- 68
            |:.|..|...|:.|||.||||:|||.||||:|.|.:.|||..||||||||.|||:.||::..|: 
plant     8 SVSLDGVRDKNLMQLKILNTVLFPVRYNDKYYADAIAAGEFTKLAYYNDICVGAIACRLEKKESG 72

  Fly    69 QRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVD 133
            ..|:||||||.|:|||.:|||:.:..|:::...|. |...|:||||.||..||:|||||||||.|
plant    73 AMRVYIMTLGVLAPYRGIGIGSNLLNHVLDMCSKQ-NMCEIYLHVQTNNEDAIKFYKKFGFEITD 136

  Fly   134 TKEQYYKRIEPADAHVLQKTLRRTAPN 160
            |.:.||..|||.|.:|:.|:..::..|
plant   137 TIQNYYINIEPRDCYVVSKSFAQSEAN 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 67/118 (57%)
Acetyltransf_1 50..130 CDD:278980 43/80 (54%)
AT5G11340NP_196695.1 Acetyltransf_1 27..132 CDD:366181 59/105 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2418
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H137620
Inparanoid 1 1.050 171 1.000 Inparanoid score I1539
OMA 1 1.010 - - QHG53503
OrthoDB 1 1.010 - - D1536763at2759
OrthoFinder 1 1.000 - - FOG0002246
OrthoInspector 1 1.000 - - oto2943
orthoMCL 1 0.900 - - OOG6_102120
Panther 1 1.100 - - LDO PTHR42919
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.