DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and NAA60

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001304022.1 Gene:NAA60 / 79903 HGNCID:25875 Length:249 Species:Homo sapiens


Alignment Length:159 Identity:43/159 - (27%)
Similarity:66/159 - (41%) Gaps:28/159 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKL-AYYNDIVVGAVCCRIDN 65
            ||..|......|...|....|:.......|.|.:|.|:....:...| |.|...:||.:...|.|
Human    16 TRKKIAYRKAVPGGRKCGASLSWEKSSREYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKN 80

  Fly    66 ----------------TENQRRLYIMTLGCLSPYRRLGIGTVMFE----HIMNFAEKDGNFDSIF 110
                            :.:.:..||::||.:..:|:.|||:::.|    ||...|:  .:..:|:
Human    81 RTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQ--DHCKAIY 143

  Fly   111 LHVQINNNGAIEFYKKFGFEIVDTKEQYY 139
            |||...||.||.||     |..|.|:.:|
Human   144 LHVLTTNNTAINFY-----ENRDFKQHHY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 37/134 (28%)
Acetyltransf_1 50..130 CDD:278980 27/99 (27%)
NAA60NP_001304022.1 RimI <44..173 CDD:223532 37/131 (28%)
Acetyltransf_1 86..163 CDD:278980 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.