DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and nat8l

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001077308.1 Gene:nat8l / 564754 ZFINID:ZDB-GENE-030729-4 Length:282 Species:Danio rerio


Alignment Length:107 Identity:29/107 - (27%)
Similarity:45/107 - (42%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FYVDVLEAGELAKLAYYNDIVVGAVCCRI---DNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHI 96
            |:|.||: |:          |||.|..:.   |||...||:.:.     |.:|..||...:...:
Zfish   164 FWVAVLQ-GQ----------VVGIVAAQSREDDNTVELRRMSVD-----SHFRGKGIAKALGRRV 212

  Fly    97 MNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQY 138
            :.||..: |:.::.|........|.:.|:..||..|...|.|
Zfish   213 IEFAMLN-NYSAVVLGTTAVKMAAHKLYESLGFRRVGETEDY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 29/107 (27%)
Acetyltransf_1 50..130 CDD:278980 20/82 (24%)
nat8lNP_001077308.1 Acetyltransf_1 171..245 CDD:278980 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.