Sequence 1: | NP_524779.1 | Gene: | san / 44724 | FlyBaseID: | FBgn0024188 | Length: | 184 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_063923.1 | Gene: | Naa10 / 56292 | MGIID: | 1915255 | Length: | 235 | Species: | Mus musculus |
Alignment Length: | 157 | Identity: | 34/157 - (21%) |
---|---|---|---|
Similarity: | 76/157 - (48%) | Gaps: | 6/157 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 IELGDVTPHNIKQLKKLNTVVFPVSYNDKFY-VDVLEAGELAKLAY-YNDIVVGAVCCRI-DNTE 67
Fly 68 NQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKK-FGFEI 131
Fly 132 VDTKEQYYKRIEPADAHVLQKTLRRTA 158 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
san | NP_524779.1 | RimI | <27..145 | CDD:223532 | 28/121 (23%) |
Acetyltransf_1 | 50..130 | CDD:278980 | 17/82 (21%) | ||
Naa10 | NP_063923.1 | RimI | 1..149 | CDD:223532 | 32/149 (21%) |
Interaction with NAA15. /evidence=ECO:0000250 | 1..58 | 13/56 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 196..235 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |