DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and naa50

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_031751771.1 Gene:naa50 / 496547 XenbaseID:XB-GENE-996002 Length:170 Species:Xenopus tropicalis


Alignment Length:163 Identity:120/163 - (73%)
Similarity:143/163 - (87%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRIDN 65
            |..|.|||||||||||||||:||.|:||||||||||.||||.||||||||:|||.|||||||:|:
 Frog     1 MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDH 65

  Fly    66 TENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFE 130
            ::||:||||||||||:|||||||||.|..|::|..||||.||:|:|||||:|..||:||:|||||
 Frog    66 SQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFE 130

  Fly   131 IVDTKEQYYKRIEPADAHVLQKTLRRTAPNSNS 163
            |::||:.|||||||||||||||.|:.::|..|:
 Frog   131 IIETKKNYYKRIEPADAHVLQKNLKISSPGQNA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 88/117 (75%)
Acetyltransf_1 50..130 CDD:278980 56/79 (71%)
naa50XP_031751771.1 RimI 10..145 CDD:223532 102/134 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4678
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3002
OMA 1 1.010 - - QHG53503
OrthoDB 1 1.010 - - D1536763at2759
OrthoFinder 1 1.000 - - FOG0002246
OrthoInspector 1 1.000 - - otm48949
Panther 1 1.100 - - O PTHR42919
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2079
SonicParanoid 1 1.000 - - X2263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.