powered by:
Protein Alignment san and rnf113a
DIOPT Version :9
Sequence 1: | NP_524779.1 |
Gene: | san / 44724 |
FlyBaseID: | FBgn0024188 |
Length: | 184 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001004536.1 |
Gene: | rnf113a / 446116 |
ZFINID: | ZDB-GENE-040825-1 |
Length: | 321 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 25/68 - (36%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 NGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVLQKTLRRTAPN--SNSTATSTTANSNSRSKARQ 180
|..|:..||...|.|.:.|...:: |.....|..|:.|...|. .:..||:.......|.|..|
Zfish 56 NPMIQKTKKVEREAVSSSESEEEK-EEKSVTVAYKSTRSAKPEGPDDMGATAVYELDTERDKDAQ 119
Fly 181 FTF 183
..|
Zfish 120 AIF 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2079 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.