DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and rnf113a

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001004536.1 Gene:rnf113a / 446116 ZFINID:ZDB-GENE-040825-1 Length:321 Species:Danio rerio


Alignment Length:68 Identity:18/68 - (26%)
Similarity:25/68 - (36%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVLQKTLRRTAPN--SNSTATSTTANSNSRSKARQ 180
            |..|:..||...|.|.:.|...:: |.....|..|:.|...|.  .:..||:.......|.|..|
Zfish    56 NPMIQKTKKVEREAVSSSESEEEK-EEKSVTVAYKSTRSAKPEGPDDMGATAVYELDTERDKDAQ 119

  Fly   181 FTF 183
            ..|
Zfish   120 AIF 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 8/26 (31%)
Acetyltransf_1 50..130 CDD:278980 4/11 (36%)
rnf113aNP_001004536.1 COG5152 23..309 CDD:227481 18/68 (26%)
zf-CCCH 185..211 CDD:279036
zf-C3HC4_3 249..289 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2079
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.