DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and naa50

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_005162748.1 Gene:naa50 / 445229 ZFINID:ZDB-GENE-040801-142 Length:169 Species:Danio rerio


Alignment Length:155 Identity:119/155 - (76%)
Similarity:139/155 - (89%) Gaps:0/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRIDN 65
            |..|.|||||||||||||||:||.|:||||||||||.||||.||||||||:|||.|||||||:|:
Zfish     1 MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDH 65

  Fly    66 TENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFE 130
            ::||:||||||||||:|||||||||.|..|::|..||||.||:|:|||||:|..||:||:|||||
Zfish    66 SQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYQKFGFE 130

  Fly   131 IVDTKEQYYKRIEPADAHVLQKTLR 155
            |::||:.|||||||||||||||:||
Zfish   131 IIETKKNYYKRIEPADAHVLQKSLR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 88/117 (75%)
Acetyltransf_1 50..130 CDD:278980 56/79 (71%)
naa50XP_005162748.1 RimI 10..145 CDD:223532 102/134 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595930
Domainoid 1 1.000 140 1.000 Domainoid score I4715
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 258 1.000 Inparanoid score I3128
OMA 1 1.010 - - QHG53503
OrthoDB 1 1.010 - - D1536763at2759
OrthoFinder 1 1.000 - - FOG0002246
OrthoInspector 1 1.000 - - oto41486
orthoMCL 1 0.900 - - OOG6_102120
Panther 1 1.100 - - LDO PTHR42919
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2079
SonicParanoid 1 1.000 - - X2263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.