DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Naa60

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_008765741.1 Gene:Naa60 / 363545 RGDID:1308915 Length:295 Species:Rattus norvegicus


Alignment Length:210 Identity:43/210 - (20%)
Similarity:71/210 - (33%) Gaps:81/210 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKL-AYYNDIVVGAVCCRIDN-- 65
            |.:.|..:...:|..:|.|....||:.|.|.:|.|:....:...| |.|...:||.:...|.|  
  Rat    11 SEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRT 75

  Fly    66 ----------------------------------------------------------------- 65
                                                                             
  Rat    76 KIHKETGIHCVLAGLKLRPACLCLSSAGVQDRAPMRGLLEVVSLEVKEVSLKQQLVGRDGDILAS 140

  Fly    66 --TENQRRLYIMTLGCLSPYRRLGIGTVMFE----HIMNFAEKDGNFDSIFLHVQINNNGAIEFY 124
              :.:.:..||::||.:..:|:.|||:::.|    ||...|:  .:..:|:|||...||.||.||
  Rat   141 SFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQ--DHCKAIYLHVLTTNNTAINFY 203

  Fly   125 KKFGFEIVDTKEQYY 139
                 |..|.::.:|
  Rat   204 -----ENRDFRQHHY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 38/187 (20%)
Acetyltransf_1 50..130 CDD:278980 27/152 (18%)
Naa60XP_008765741.1 Acetyltransf_1 <137..208 CDD:395465 23/77 (30%)
TIM <192..>256 CDD:419668 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.