DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Naa20B

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster


Alignment Length:151 Identity:37/151 - (24%)
Similarity:64/151 - (42%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IKQLKKLNTVVF-PVS--YNDKFYV-DVLEAGELAKLAYYND-----IVVGAVCCRIDN------ 65
            ::.|.|.|.:|. |::  |:..|.: .:||..||...|...|     .::|.   |:::      
  Fly     9 LEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGT---RVEDATESFG 70

  Fly    66 ---TENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKF 127
               |......:|..|.....||:||:||.:...:.:..::..:| .|.|.|:..|..||..|:..
  Fly    71 DAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDF-YIDLFVREKNTIAIGLYESL 134

  Fly   128 GFEIVDTKEQYYKRIEPADAH 148
            |:.......::|     ||.|
  Fly   135 GYVKYRWIPKFY-----ADDH 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 30/135 (22%)
Acetyltransf_1 50..130 CDD:278980 21/93 (23%)
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 32/133 (24%)
Acetyltransf_1 50..137 CDD:278980 21/90 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.