DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and CG31730

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster


Alignment Length:148 Identity:37/148 - (25%)
Similarity:69/148 - (46%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKKLNTVVFPV---SYNDKFYV-DVLEAGELAKLAYY---NDIVVGAVCCRIDNTENQRRL-YIM 75
            |.|:|::||..   .|:..|:| ..||...|:::|..   :...:|.:..:.....||... ::.
  Fly    12 LFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQVKRNQDPYGHVA 76

  Fly    76 TLGCLSPYRRLGIGTVMFEHIMNFAE-KDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYY 139
            .|.....|||||:.|.:.:.....:: |..::.::|:  :|:|..|.:.|...|:....|...||
  Fly    77 ALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFM--RISNRAAYQLYTSLGYAHRQTFLDYY 139

  Fly   140 -KRIEPADAHVLQKTLRR 156
             ...:|..|:.|:|.:.|
  Fly   140 PDEPKPESAYELRKYVPR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 28/127 (22%)
Acetyltransf_1 50..130 CDD:278980 17/84 (20%)
CG31730NP_723799.1 rimI 9..141 CDD:273701 32/130 (25%)
Acetyltransf_1 52..129 CDD:278980 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.