DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Naa30A

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster


Alignment Length:104 Identity:33/104 - (31%)
Similarity:50/104 - (48%) Gaps:3/104 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ELAKLAYYNDIVVGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDS 108
            :|..||.:::..|||:.|::|...|.||.||..|.....||:|.|||.:....:.....| |.|.
  Fly   269 KLCFLASHDNQYVGAIVCKLDMHMNVRRGYIAMLAVRKEYRKLKIGTTLVTKAIEAMLAD-NADE 332

  Fly   109 IFLHVQINNNGAIEFYKKFGFEIVDTKEQYYKRIEPADA 147
            :.|..::.|..|:..|:..||  |..|..:...:...||
  Fly   333 VVLETEMRNQPALRLYENLGF--VRDKRLFRYYLNGVDA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 31/100 (31%)
Acetyltransf_1 50..130 CDD:278980 25/79 (32%)
Naa30ANP_726727.1 rimI 242..370 CDD:273701 33/104 (32%)
Acetyltransf_1 276..354 CDD:278980 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.