DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Naa50

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001296733.1 Gene:Naa50 / 288108 RGDID:1310944 Length:169 Species:Rattus norvegicus


Alignment Length:171 Identity:124/171 - (72%)
Similarity:145/171 - (84%) Gaps:2/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRIDN 65
            |..|.|||||||||||||||:||.|:||||||||||.||||.||||||||:|||.|||||||:|:
  Rat     1 MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDH 65

  Fly    66 TENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFE 130
            ::||:||||||||||:|||||||||.|..|::|..||||.||:|:|||||:|..||:||:|||||
  Rat    66 SQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFE 130

  Fly   131 IVDTKEQYYKRIEPADAHVLQKTLRRTAPNSNSTATSTTAN 171
            |::||:.|||||||||||||||:||  .|:..|..|..|.|
  Rat   131 IIETKKNYYKRIEPADAHVLQKSLR--VPSGQSAETQKTDN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 88/117 (75%)
Acetyltransf_1 50..130 CDD:278980 56/79 (71%)
Naa50NP_001296733.1 RimI 10..145 CDD:223532 102/134 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353781
Domainoid 1 1.000 141 1.000 Domainoid score I4600
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I2995
OMA 1 1.010 - - QHG53503
OrthoDB 1 1.010 - - D1536763at2759
OrthoFinder 1 1.000 - - FOG0002246
OrthoInspector 1 1.000 - - otm45858
orthoMCL 1 0.900 - - OOG6_102120
Panther 1 1.100 - - O PTHR42919
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.