DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and cwf24

DIOPT Version :10

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_596257.1 Gene:cwf24 / 2540186 PomBaseID:SPBC13E7.02 Length:533 Species:Schizosaccharomyces pombe


Alignment Length:150 Identity:56/150 - (37%)
Similarity:82/150 - (54%) Gaps:17/150 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRI--DNTENQRRL 72
            ::|..||...|:|..||...||:||||..||:..:.|::|.:.|..|||:...:  ||:     |
pombe   383 EITESNIVHFKRLVRVVLEASYSDKFYRLVLKNPDYARIATFEDKFVGAISSLVAEDNS-----L 442

  Fly    73 YIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQ 137
            |:..|..|:|||.||||:::.:|:...| .:.|.|.|.||||..|...|::|...||:||.....
pombe   443 YVTVLCVLAPYRCLGIGSLLIDHVKKTA-INNNIDRISLHVQTTNESVIKWYTAHGFKIVKQIND 506

  Fly   138 YYKRIE---------PADAH 148
            :|:|:|         |..||
pombe   507 FYRRLENKSAFYMVCPLSAH 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 Acetyltransf_1 24..129 CDD:395465 41/106 (39%)
cwf24NP_596257.1 COG5152 24..314 CDD:227481
RimI 431..524 CDD:440224 34/98 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.