DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Kat14

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_852082.2 Gene:Kat14 / 228714 MGIID:1917264 Length:779 Species:Mus musculus


Alignment Length:124 Identity:35/124 - (28%)
Similarity:53/124 - (42%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DVLEAGELAKLAYYNDIVVGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEH-IMNFAE 101
            :.|:..:.:.:..|..::|.......|...|:  .||..|.....:||.||.|.|..| |.....
Mouse   664 ECLQYPDFSVVVLYKKVIVAFGFMVPDVKYNE--AYISFLLVHPEWRRAGIATFMIYHLIQTCMG 726

  Fly   102 KDGNFDSIFLHVQINNNGAIEFYKKFGFE----IVDTKEQYYKRIEPADAHVLQKTLRR 156
            ||     :.|||.. :|.|:..|:||||:    ::|..::||........|.....|||
Mouse   727 KD-----VTLHVSA-SNPAMLLYQKFGFKTEEYVLDFYDKYYPLESTECKHAFFLRLRR 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 31/111 (28%)
Acetyltransf_1 50..130 CDD:278980 26/80 (33%)
Kat14NP_852082.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..292
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..345
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..457
RimI 648..760 CDD:223532 29/103 (28%)
Acetyltransf_1 680..749 CDD:278980 25/76 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.