DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and natb-1

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_505053.1 Gene:natb-1 / 190814 WormBaseID:WBGene00022394 Length:173 Species:Caenorhabditis elegans


Alignment Length:150 Identity:38/150 - (25%)
Similarity:71/150 - (47%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PHNIKQLKKLNTVVFPV---SYNDKFYVD-VLEAGELAKLAYY-NDIVVGAVCCRIDNTENQRRL 72
            |.::..:.|.|.|...:   :|..:||:. ::...|..::|.: |..::..|..:|:..:.....
 Worm     6 PFDVMDMFKFNNVNLDINTETYGFQFYLHYMMNYPEYYQVAEHPNGEIMAYVMGKIEGRDTNWHG 70

  Fly    73 YIMTLGCLSPYRRLGIGTVMFEHIMNFAE-KDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKE 136
            ::..|.....:||||:...|.|.:...:| :...|..:|  |:::|..|||.|||.|:.:.....
 Worm    71 HVTALSVAPNFRRLGLAAYMMEFLERTSEARRAYFVDLF--VRVSNKIAIELYKKLGYVVYRQII 133

  Fly   137 QYYKRIEPADAHVLQKTLRR 156
            .||......||..::|:|.|
 Worm   134 GYYTGDRDEDAFDMRKSLSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 29/123 (24%)
Acetyltransf_1 50..130 CDD:278980 22/81 (27%)
natb-1NP_505053.1 RimI 1..149 CDD:223532 35/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.