DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and F40F4.7

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001379902.1 Gene:F40F4.7 / 180614 WormBaseID:WBGene00018238 Length:245 Species:Caenorhabditis elegans


Alignment Length:151 Identity:79/151 - (52%)
Similarity:111/151 - (73%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRIDNTENQ 69
            ::.||::|||||.||||||..|||::|||||||:....|||.:||||||:||||||||||:..::
 Worm    95 TVHLGEITPHNILQLKKLNEDVFPIAYNDKFYVEARYCGELGRLAYYNDVVVGAVCCRIDDISDE 159

  Fly    70 RRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDT 134
            :.||:||||.|:.||::||||::.::.:....|.....:::||||:||..|::||:|.||.....
 Worm   160 KSLYLMTLGTLAAYRQIGIGTILIDYALKLCNKMEEIKTMYLHVQVNNKNAVQFYEKHGFTNDGI 224

  Fly   135 KEQYYKRIEPADAHVLQKTLR 155
            .|.|| ||.|.||::|.|.:|
 Worm   225 IEDYY-RISPRDAYLLIKRIR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 59/117 (50%)
Acetyltransf_1 50..130 CDD:278980 39/79 (49%)
F40F4.7NP_001379902.1 RimI <122..245 CDD:223532 62/124 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167250
Domainoid 1 1.000 104 1.000 Domainoid score I4247
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H137620
Inparanoid 1 1.050 174 1.000 Inparanoid score I2709
Isobase 1 0.950 - 0 Normalized mean entropy S1394
OMA 1 1.010 - - QHG53503
OrthoDB 1 1.010 - - D1536763at2759
OrthoFinder 1 1.000 - - FOG0002246
OrthoInspector 1 1.000 - - oto19683
orthoMCL 1 0.900 - - OOG6_102120
Panther 1 1.100 - - LDO PTHR42919
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2079
SonicParanoid 1 1.000 - - X2263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.