DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and F54E7.9

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_498219.1 Gene:F54E7.9 / 175784 WormBaseID:WBGene00018831 Length:167 Species:Caenorhabditis elegans


Alignment Length:156 Identity:57/156 - (36%)
Similarity:85/156 - (54%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TRSSIE--LGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRID 64
            |.:|:|  |..||..|||.::.|.:.:|||||:||||.:.:. .||..:...|...:..|..:.:
 Worm    14 TDNSLELRLQRVTAENIKTVRILVSSIFPVSYSDKFYQECMN-NELTGVVIRNGEAIAIVAVKPE 77

  Fly    65 NTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSI---FLHVQINNNGAIEFYKK 126
            |.|..|.|||.:.|....:|..|:|:    .:|:|.::.|....:   .||||.:|..||||||.
 Worm    78 NFETGRVLYIRSFGVHPRHREAGLGS----FLMDFVDEKGKLLKLPHAMLHVQTSNKTAIEFYKN 138

  Fly   127 FGFEIVDTKEQYYKRIEPADAHVLQK 152
            .||.:.....|||:|..|.||.:::|
 Worm   139 RGFNVDCLVPQYYQRCSPPDAFIMRK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 43/120 (36%)
Acetyltransf_1 50..130 CDD:278980 27/82 (33%)
F54E7.9NP_498219.1 Acetyltransf_1 30..141 CDD:366181 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1394
OMA 1 1.010 - - QHG53503
OrthoDB 1 1.010 - - D1536763at2759
OrthoFinder 1 1.000 - - FOG0002246
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42919
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.