DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Nat8b

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_598242.1 Gene:Nat8b / 171084 RGDID:621605 Length:222 Species:Rattus norvegicus


Alignment Length:94 Identity:23/94 - (24%)
Similarity:41/94 - (43%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VLEAGELAKLAYYNDIV--VGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAE 101
            |.|:||        .:|  |||:..: :....:::|.:..|...|.:|..||...:...::.|| 
  Rat   111 VAESGE--------QVVGTVGALPVK-EPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFA- 165

  Fly   102 KDGNFDSIFLHVQINNNGAIEFYKKFGFE 130
            :|..:..:.|.......||:..|...||:
  Rat   166 RDQGYTDVVLETSTMQIGAVTLYLGMGFQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 23/94 (24%)
Acetyltransf_1 50..130 CDD:278980 18/81 (22%)
Nat8bNP_598242.1 hydrophobic domain 36..80
Acetyltransf_1 91..193 CDD:395465 21/91 (23%)
consensus motif D 109..126 8/22 (36%)
consensus motif A 131..166 8/35 (23%)
consensus motif B 174..194 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.