powered by:
Protein Alignment san and RNF113B
DIOPT Version :9
Sequence 1: | NP_524779.1 |
Gene: | san / 44724 |
FlyBaseID: | FBgn0024188 |
Length: | 184 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_849192.1 |
Gene: | RNF113B / 140432 |
HGNCID: | 17267 |
Length: | 322 |
Species: | Homo sapiens |
Alignment Length: | 50 |
Identity: | 12/50 - (24%) |
Similarity: | 21/50 - (42%) |
Gaps: | 8/50 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 LAKLAYYNDIVVGA---VC--CRIDNTENQRRLYIM---TLGCLSPYRRL 86
:.:.|:.|.:|... .| |.:::.....|.||. |.|..:|.:.|
Human 258 ICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKEL 307
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2079 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.