DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Nat8f3

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_543159.1 Gene:Nat8f3 / 113892 RGDID:621607 Length:228 Species:Rattus norvegicus


Alignment Length:71 Identity:21/71 - (29%)
Similarity:33/71 - (46%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVD 133
            :::|.:..|.....:||.|||..|....:.|||..| |..:.|...:....|:..|:..||:  .
  Rat   134 RKQLQLRHLSVSLEHRREGIGRAMVRTALQFAEMQG-FSEVVLVTSMLQYAALALYQSMGFQ--K 195

  Fly   134 TKEQYY 139
            |.|.:|
  Rat   196 TGEFFY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 21/71 (30%)
Acetyltransf_1 50..130 CDD:278980 17/60 (28%)
Nat8f3NP_543159.1 Acetyltransf_7 107..195 CDD:379228 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.