powered by:
Protein Alignment san and Nat8f3
DIOPT Version :9
Sequence 1: | NP_524779.1 |
Gene: | san / 44724 |
FlyBaseID: | FBgn0024188 |
Length: | 184 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_543159.1 |
Gene: | Nat8f3 / 113892 |
RGDID: | 621607 |
Length: | 228 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 33/71 - (46%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 QRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVD 133
:::|.:..|.....:||.|||..|....:.|||..| |..:.|...:....|:..|:..||: .
Rat 134 RKQLQLRHLSVSLEHRREGIGRAMVRTALQFAEMQG-FSEVVLVTSMLQYAALALYQSMGFQ--K 195
Fly 134 TKEQYY 139
|.|.:|
Rat 196 TGEFFY 201
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.