DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and Nat8f6

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001188318.1 Gene:Nat8f6 / 100504710 MGIID:3779382 Length:226 Species:Mus musculus


Alignment Length:86 Identity:24/86 - (27%)
Similarity:40/86 - (46%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VGAVCCR--IDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNN 118
            ||.|..|  .|....:::|.::.|.....:||.|:|..|...::.||:..| |..:.|...:...
Mouse   119 VGMVAARPVKDPLLQKKQLQLLHLSVSLQHRREGLGKAMVRTVLQFAQMQG-FSEVVLSTSMLQY 182

  Fly   119 GAIEFYKKFGFEIVDTKEQYY 139
            .|:..|:..||:  .|.|.:|
Mouse   183 AALALYQGMGFQ--KTGETFY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 24/86 (28%)
Acetyltransf_1 50..130 CDD:278980 20/75 (27%)
Nat8f6NP_001188318.1 RimI <99..198 CDD:223532 22/81 (27%)
Acetyltransf_1 116..194 CDD:278980 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.