DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lolal and ZBTB37

DIOPT Version :9

Sequence 1:	NP_001163186.1	Gene:	lolal / 44703	FlyBaseID:	FBgn0022238	Length:	127	Species:	Drosophila melanogaster
Sequence 2:	NP_001116242.1	Gene:	ZBTB37 / 84614	HGNCID:	28365	Length:	503	Species:	Homo sapiens

Alignment Length:	111	Identity:	29/111 - (26%)
Similarity:	59/111 - (53%)	Gaps:	3/111 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 DFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENP-SKHPIIILKDV 77
            ||..::::....||.:....|:.:..:||..:|||:||:|.||||:..:..|. |...|.::|:.
Human    13 DFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDHMSLNEMSTVSISVIKNP 77

  Fly    78 SYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSI 123
            :.  .:.:|.|.|.|.:.:....:.::|..|..|:::.:.:..:.|
Human    78 TV--FEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKCTQI 121

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lolal	NP_001163186.1	BTB_POZ_BAB-like	32..115	CDD:349624	24/83 (29%)
ZBTB37	NP_001116242.1	BTB_POZ_ZBTB37	7..129	CDD:349531	29/111 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	140..206
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	280..344
		C2H2 Zn finger	375..395	CDD:275368
		zf-H2C2_2	387..412	CDD:404364
		zf-C2H2	401..423	CDD:395048
		C2H2 Zn finger	403..423	CDD:275368
		zf-H2C2_2	416..438	CDD:404364
		C2H2 Zn finger	431..449	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	457..503
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910