DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and AT1G55760

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_175972.1 Gene:AT1G55760 / 842025 AraportID:AT1G55760 Length:329 Species:Arabidopsis thaliana


Alignment Length:141 Identity:36/141 - (25%)
Similarity:62/141 - (43%) Gaps:36/141 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSSDQ-QFFLKW------NDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYF 58
            ::|.|. :.:..|      |..|...|||...:..|..:||:|:.....:..||:.||:|.||.|
plant   125 VLSQDSGELYSIWANGSTENQSQVTAVTSLGRMLTESIYTDITINASDGSIGAHRAVLAARSPVF 189

  Fly    59 KAL----LEENPSKHPIIILKDVSYIHL--------QAILEFMYAGEVNVSQEQL----PAFLKT 107
            :::    |:|          |::|.|::        ||.|.::|.   |:..|..    .|.|:.
plant   190 RSMFLHDLKE----------KELSEINVLDMPLDACQAFLSYIYG---NIQNEDFLIHRLALLQA 241

  Fly   108 ADRLKVKGLAE 118
            |::..:..|.|
plant   242 AEKYDIADLKE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 25/98 (26%)
AT1G55760NP_175972.1 BTB 154..255 CDD:279045 28/112 (25%)
BTB 165..262 CDD:197585 26/101 (26%)
BACK_like 262..318 CDD:297737
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2685
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.