DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and AT4G04090

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_192318.1 Gene:AT4G04090 / 825720 AraportID:AT4G04090 Length:192 Species:Arabidopsis thaliana


Alignment Length:105 Identity:26/105 - (24%)
Similarity:45/105 - (42%) Gaps:30/105 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AHKMVLSACSPYFKALLEEN----PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQ-------- 98
            |||.:|||.|..|:.:.|.:    .||...|.|.::.:..|:|.::|.|:....:|:        
plant    40 AHKRILSARSEVFEEMFESDKYKASSKLETITLSEMKHEVLEAFVDFTYSDGSMLSEKAKQHAMS 104

  Fly    99 ------------------EQLPAFLKTADRLKVKGLAETP 120
                              ::|.|.|..::.|:|..||:.|
plant   105 LYSAAKDYEIPRLWCLCRKELIASLNMSNALRVLQLAQIP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 23/98 (23%)
AT4G04090NP_192318.1 BTB 18..126 CDD:279045 18/85 (21%)
BTB 24..129 CDD:197585 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2685
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.