DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and AT3G29740

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_189617.1 Gene:AT3G29740 / 822660 AraportID:AT3G29740 Length:87 Species:Arabidopsis thaliana


Alignment Length:84 Identity:27/84 - (32%)
Similarity:38/84 - (45%) Gaps:12/84 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QTN---MVTSFRHLRDEKSFTDVTLAC-----EGQTCKAHKMVLSACSPYFKALLEENPSKH--- 69
            |||   .|.....:..|:...||.|..     :|.:..|||:||||.|..||.:||....|.   
plant     4 QTNKELFVGGLARILKEQRQVDVRLKAGDSDQKGVSISAHKLVLSARSEVFKMILETEEIKATTT 68

  Fly    70 -PIIILKDVSYIHLQAILE 87
             ..|.|.::.:..|.|::|
plant    69 LDTITLSELKHTELVALVE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 22/65 (34%)
AT3G29740NP_189617.1 BTB 18..>87 CDD:413352 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.