powered by:
Protein Alignment lolal and AT2G40440
DIOPT Version :9
Sequence 1: | NP_001163186.1 |
Gene: | lolal / 44703 |
FlyBaseID: | FBgn0022238 |
Length: | 127 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_181576.2 |
Gene: | AT2G40440 / 818638 |
AraportID: | AT2G40440 |
Length: | 90 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 30/65 - (46%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 VTSFRHLRDEKSFTDVTLACEGQT--CKAHKMVLSACSPYFKALLEENPSKHPIIILKDVSYIHL 82
:.||.....||...||.|....|| ..|||::|:|.|...|.:::...|....|...::::..|
plant 8 IDSFAKYWKEKVGVDVLLKAGDQTDPIPAHKIILAASSEVLKQMIDSTSSASDPITFSEMTHDEL 72
Fly 83 82
plant 73 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
44 |
1.000 |
Inparanoid score |
I2685 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.050 |
|
Return to query results.
Submit another query.