DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and BTBD18

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001138573.1 Gene:BTBD18 / 643376 HGNCID:37214 Length:712 Species:Homo sapiens


Alignment Length:106 Identity:37/106 - (34%)
Similarity:58/106 - (54%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLE-ENPSKHPIIILK--DVSYIHLQAIL 86
            |.:....|.||.|..||:...||..:||||||:|...|| |.|::...::|:  .:....|:.::
Human    26 HQQQSDVFCDVLLQAEGEAVPAHCCILSACSPFFTERLERERPAQGGKVVLELGGLKISTLRKLV 90

  Fly    87 EFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG 127
            :|:|..|:.||||:....|..|.:|:|..|    .|::.||
Human    91 DFLYTSEMEVSQEEAQDVLSAARQLRVSEL----ESLQLEG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 32/85 (38%)
BTBD18NP_001138573.1 BTB 24..120 CDD:306997 33/93 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..410
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.