DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and mod(mdg4)

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_788698.1 Gene:mod(mdg4) / 49228 FlyBaseID:FBgn0002781 Length:610 Species:Drosophila melanogaster


Alignment Length:118 Identity:55/118 - (46%)
Similarity:79/118 - (66%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENP 66
            |:.|:||.|.||:|.||:...|..........||:||.|||..|||::|||.|||:|:.:..:.|
  Fly     1 MADDEQFSLCWNNFNTNLSAGFHESLCRGDLVDVSLAAEGQIVKAHRLVLSVCSPFFRKMFTQMP 65

  Fly    67 SK-HPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118
            |. |.|:.|.:||:..|:.:::|||.|||||.|:.||||:.||:.|::|||.:
  Fly    66 SNTHAIVFLNNVSHSALKDLIQFMYCGEVNVKQDALPAFISTAESLQIKGLTD 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 41/83 (49%)
mod(mdg4)NP_788698.1 BTB_POZ_BAB-like 31..115 CDD:349624 41/83 (49%)
FLYWCH 452..512 CDD:461332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.