DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and br

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster


Alignment Length:117 Identity:63/117 - (53%)
Similarity:95/117 - (81%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENP 66
            |...|.|.|:||::|:::.::|.:|||:::|.||||||||::.|||::|||||||||:.||:..|
  Fly     1 MDDTQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTP 65

  Fly    67 SKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118
            .|||:|:|:||:::.|.|::||:|.|||||.|:.|.:|||||:.|:|.||.:
  Fly    66 CKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQ 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 50/82 (61%)
brNP_001162638.2 BTB 22..118 CDD:279045 56/96 (58%)
BTB 33..118 CDD:197585 51/85 (60%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1752
65.920

Return to query results.
Submit another query.