DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and bab2

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_523879.2 Gene:bab2 / 44254 FlyBaseID:FBgn0025525 Length:1067 Species:Drosophila melanogaster


Alignment Length:122 Identity:69/122 - (56%)
Similarity:94/122 - (77%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHP 70
            |||.|:||::|:|:...|..|...:||.||||:|||.:.||||||||||||||:||..:||.:||
  Fly   196 QQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYDNPCQHP 260

  Fly    71 IIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG 127
            |||::|||:..|:|::||||.||:||.|:|:...||.|:.||::||||. |:.:.||
  Fly   261 IIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAEV-SAGRGEG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 51/82 (62%)
bab2NP_523879.2 BTB 213..309 CDD:279045 57/95 (60%)
BTB 224..309 CDD:197585 53/84 (63%)
HTH_psq 645..690 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447053
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.