DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and CG6118

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001097806.1 Gene:CG6118 / 41884 FlyBaseID:FBgn0038339 Length:967 Species:Drosophila melanogaster


Alignment Length:110 Identity:55/110 - (50%)
Similarity:76/110 - (69%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPI 71
            |:.|.||:|..||...|..|:.::...|||:|..|:..||||:|||.|||||:.:..||||.|||
  Fly   392 QYLLSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYFQQIFLENPSSHPI 456

  Fly    72 IILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGL 116
            :::.||...|:..:|:|||:|:|||..|.||.|||.|:.:|:|||
  Fly   457 LLMADVEASHMAGLLDFMYSGQVNVKYEDLPVFLKVAEAMKIKGL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 43/82 (52%)
CG6118NP_001097806.1 Myb_DNA-bind_4 20..97 CDD:463994
BTB_POZ_BAB-like 418..500 CDD:349624 43/81 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.