DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and CG6765

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648233.1 Gene:CG6765 / 38971 FlyBaseID:FBgn0035903 Length:681 Species:Drosophila melanogaster


Alignment Length:133 Identity:39/133 - (29%)
Similarity:66/133 - (49%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQT-----------CKAHKMVLSACSPYFK 59
            :.:.|||:...|.:.:|...|...:.|.||.|.....:           ..|||.:|||.|.:|.
  Fly     4 ENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFA 68

  Fly    60 ALLEENPSKHP-----IIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAET 119
            .:.|..|..:|     :::..|:|:..:|.::::||:||..||.:.|...|:..:.||::||..|
  Fly    69 TMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT 133

  Fly   120 PSS 122
            .||
  Fly   134 SSS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 28/98 (29%)
CG6765NP_648233.1 BTB_POZ 53..129 CDD:453885 24/75 (32%)

Return to query results.
Submit another query.