DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and lov

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_611994.3 Gene:lov / 38007 FlyBaseID:FBgn0266129 Length:1143 Species:Drosophila melanogaster


Alignment Length:112 Identity:49/112 - (43%)
Similarity:77/112 - (68%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPII 72
            :.|:||:.|.:::.:|..|...|:..||||.|...:.:|||||||||||:|:.:..|.|.|||:|
  Fly   115 YSLRWNNHQNHILRAFDALLKTKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPCKHPVI 179

  Fly    73 ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAET 119
            :|||.....:|||::|||.||::|.|::|...::..:.|:|:||.|:
  Fly   180 VLKDFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQVRGLVES 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 39/82 (48%)
lovNP_611994.3 BTB 130..225 CDD:279045 44/94 (47%)
BTB 141..226 CDD:197585 41/84 (49%)
HTH_psq 791..834 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.