DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and psq

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001369078.1 Gene:psq / 36118 FlyBaseID:FBgn0263102 Length:1170 Species:Drosophila melanogaster


Alignment Length:115 Identity:60/115 - (52%)
Similarity:86/115 - (74%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHP 70
            |.|.|:||::|..|.:.|:.||::.||.||||:||..:.||||:||||||.||:.||.|||.|||
  Fly     8 QYFSLRWNNYQNTMTSVFQQLREDLSFVDVTLSCEHGSLKAHKVVLSACSTYFQKLLLENPCKHP 72

  Fly    71 IIIL-KDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAET 119
            .||| .|:.:..|:.|::|:|.||::|::.:|...|:||::||:|||.||
  Fly    73 TIILPADIIFTDLKTIIDFVYRGEIDVTESELQGLLRTAEQLKIKGLCET 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 44/83 (53%)
psqNP_001369078.1 BTB_POZ_BAB-like 34..118 CDD:349624 44/83 (53%)
HTH_psq 717..>747 CDD:283007
HTH_psq 767..804 CDD:283007
HTH_psq 821..866 CDD:283007
HTH_psq 873..916 CDD:283007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.