DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and psq

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001369078.1 Gene:psq / 36118 FlyBaseID:FBgn0263102 Length:1170 Species:Drosophila melanogaster


Alignment Length:115 Identity:60/115 - (52%)
Similarity:86/115 - (74%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHP 70
            |.|.|:||::|..|.:.|:.||::.||.||||:||..:.||||:||||||.||:.||.|||.|||
  Fly     8 QYFSLRWNNYQNTMTSVFQQLREDLSFVDVTLSCEHGSLKAHKVVLSACSTYFQKLLLENPCKHP 72

  Fly    71 IIIL-KDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAET 119
            .||| .|:.:..|:.|::|:|.||::|::.:|...|:||::||:|||.||
  Fly    73 TIILPADIIFTDLKTIIDFVYRGEIDVTESELQGLLRTAEQLKIKGLCET 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 44/83 (53%)
psqNP_001369078.1 BTB_POZ_BAB-like 34..118 CDD:349624 44/83 (53%)
HTH_psq 717..>747 CDD:283007
HTH_psq 767..804 CDD:283007
HTH_psq 821..866 CDD:283007
HTH_psq 873..916 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.