DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and LOC3290595

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_061504414.1 Gene:LOC3290595 / 3290595 VectorBaseID:AGAMI1_013978 Length:232 Species:Anopheles gambiae


Alignment Length:80 Identity:32/80 - (40%)
Similarity:58/80 - (72%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQ 98
            |||:.||.:..:|||:||...||:|:::..|.|:.||::::.:|.|..|.|:::|:|.||::|.:
Mosquito    36 DVTICCESRKLRAHKLVLVLGSPFFRSIFNEVPTPHPVVMIYNVKYEDLDALVKFLYTGELSVER 100

  Fly    99 EQLPAFLKTADRLKV 113
            |:||:.|:.|..|::
Mosquito   101 ERLPSLLEAARYLQL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 32/80 (40%)
LOC3290595XP_061504414.1 None

Return to query results.
Submit another query.