DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and Kbtbd4

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_017447204.1 Gene:Kbtbd4 / 311185 RGDID:1310234 Length:553 Species:Rattus norvegicus


Alignment Length:93 Identity:28/93 - (30%)
Similarity:57/93 - (61%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN--PSKHPIIILKDVSYIHLQAILEFMY 90
            :|:.|.|||::.||:..:.|::||||.|.:|:::...|  .:.:.:|:|:|||....|.:::::|
  Rat    75 EEELFADVTISVEGREFQLHRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESVFQLLVDYIY 139

  Fly    91 AGEVNVSQEQLPAFLKTADRLKVKGLAE 118
            .|.|.:..::|....:.:|..::..|.|
  Rat   140 HGTVKLRADELQEIYEVSDMYQLTSLFE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 25/84 (30%)
Kbtbd4XP_017447204.1 BTB_POZ_KBTBD4 48..187 CDD:349581 28/93 (30%)
PHA03098 82..514 CDD:222983 25/86 (29%)
BACK_KBTBD4 177..264 CDD:350556
KELCH repeat 314..349 CDD:276965
KELCH repeat 353..400 CDD:276965
KELCH repeat 403..449 CDD:276965
KELCH repeat 457..502 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9480
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.