DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and Trl

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001261846.1 Gene:Trl / 2768981 FlyBaseID:FBgn0013263 Length:623 Species:Drosophila melanogaster


Alignment Length:119 Identity:48/119 - (40%)
Similarity:76/119 - (63%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPII 72
            :.|.|.|:.|::|::.:.||......|.|||..|::..|||:||.|.||:...||:..|.|||::
  Fly     9 YSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVV 73

  Fly    73 ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKRE 126
            :|..|:...|:|:|||:|.|||:|...|||:.|:.|..|.::|||  |.::.::
  Fly    74 MLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLA--PQTVTKD 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 37/82 (45%)
TrlNP_001261846.1 BTB_POZ_BAB-like 33..116 CDD:349624 37/82 (45%)
GAGA 319..372 CDD:462719
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.