DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and ZBTB43

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001129248.1 Gene:ZBTB43 / 23099 HGNCID:17908 Length:467 Species:Homo sapiens


Alignment Length:115 Identity:31/115 - (26%)
Similarity:57/115 - (49%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYF-KALLEE 64
            |......|.:::.||.:.::......|.:....||::..:|...:|||.||:|.|||| ..:|.:
Human     1 MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLK 65

  Fly    65 NPSKHPIIILKDVSYIHL-QAILEFMYAGEVNVSQEQLPAFLKTADRLKV 113
            |..:   |:|.||....: :.||...|.|.:.:...::.::|..|..|::
Human    66 NSRR---IVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQM 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 26/84 (31%)
ZBTB43NP_001129248.1 BTB_POZ_ZBTB43 8..128 CDD:349536 30/108 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..225
C2H2 Zn finger 376..394 CDD:275368
C2H2 Zn finger 402..422 CDD:275368
zf-H2C2_2 414..437 CDD:404364
C2H2 Zn finger 430..447 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.