DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lolal and ZBTB12

DIOPT Version :9

Sequence 1:	NP_001163186.1	Gene:	lolal / 44703	FlyBaseID:	FBgn0022238	Length:	127	Species:	Drosophila melanogaster
Sequence 2:	NP_862825.1	Gene:	ZBTB12 / 221527	HGNCID:	19066	Length:	459	Species:	Homo sapiens

Alignment Length:	101	Identity:	27/101 - (26%)
Similarity:	48/101 - (47%)	Gaps:	9/101 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 SFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPIIILKDVSYIHLQAIL 86
            :...||.|:.|.|||:..:....:.||::|:||||:.:.....|||..     ..||.:|...|:
Human    22 NMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSE-----LQVSLMHSARIV 81

  Fly    87 EFM----YAGEVNVSQEQLPAFLKTADRLKVKGLAE 118
            ..:    |.|.:..:...:..:|..|..|:::.:.|
Human    82 ADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVE 117

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lolal	NP_001163186.1	BTB_POZ_BAB-like	32..115	CDD:349624	23/86 (27%)
ZBTB12	NP_862825.1	BTB	23..127	CDD:306997	27/100 (27%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	153..179
		C2H2 Zn finger	335..355	CDD:275368
		zf-C2H2	359..381	CDD:306579
		COG5048	<361..>448	CDD:227381
		C2H2 Zn finger	361..381	CDD:275368
		C2H2 Zn finger	389..409	CDD:275368
		C2H2 Zn finger	417..435	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000