DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and bath-25

DIOPT Version :9

Sequence 1:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001317756.1 Gene:bath-25 / 188993 WormBaseID:WBGene00020859 Length:298 Species:Caenorhabditis elegans


Alignment Length:139 Identity:42/139 - (30%)
Similarity:61/139 - (43%) Gaps:30/139 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLKWNDFQTNMV------------------TSFRHLRDE--KSFTDVTLACEGQTCKAHKMVLSA 53
            |:.|.|.:...:                  ||:|.. ||  |.|:||.|..|.|.....|:.||.
 Worm   102 FMNWEDMENQFLIDDSIRMECHVELKYIERTSYRKF-DESAKEFSDVILVAEKQKFYVSKLFLSF 165

  Fly    54 CSPYFKALLEEN--PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGL 116
            .|.||.|||..|  .|....|.||||:..:.|..||.:: ||.:::.|.:...|..||      :
 Worm   166 QSSYFHALLLGNFIESTSSEIELKDVNSTYFQYFLELLH-GESSITAENVEHILHLAD------M 223

  Fly   117 AETPSSIKR 125
            .:..::|:|
 Worm   224 FDARTAIRR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 31/84 (37%)
bath-25NP_001317756.1 MATH 14..126 CDD:334312 3/23 (13%)
BTB 146..237 CDD:197585 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.