DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and chinmo

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_061510097.1 Gene:chinmo / 1279925 VectorBaseID:AGAMI1_005508 Length:637 Species:Anopheles gambiae


Alignment Length:113 Identity:51/113 - (45%)
Similarity:75/113 - (66%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENP--SK 68
            ||:.|||:::.:|:..:|.:|.|..:.|||||.|.|....|||::|:|||..|..|.|..|  :.
Mosquito     4 QQYCLKWSNYSSNLAAAFSNLFDSATLTDVTLVCGGTVFNAHKVILAACSKNFADLFERAPVGTG 68

  Fly    69 HPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGL 116
            ...::|:..|..::.|:|||||.|||:|||:.|.:|||.|:.|:||||
Mosquito    69 QICVMLEATSADNMHALLEFMYKGEVHVSQKALESFLKAAENLQVKGL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 39/84 (46%)
chinmoXP_061510097.1 None

Return to query results.
Submit another query.