DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coprox and LIN2

DIOPT Version :9

Sequence 1:NP_001285697.1 Gene:Coprox / 44701 FlyBaseID:FBgn0021944 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_171847.4 Gene:LIN2 / 839489 AraportID:AT1G03475 Length:386 Species:Arabidopsis thaliana


Alignment Length:326 Identity:179/326 - (54%)
Similarity:230/326 - (70%) Gaps:11/326 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AEPITDSKALLGDKENMRHRMEILIMEIQAEFCRALEAEENCGQKFKVDRWERPEGGGGITCVLQ 133
            ::.:|.|.:    ..::|.|.|.:|...|...|.|:||.|. |.|||.|.|.||.|||||:.|||
plant    68 SDDVTPSSS----SSSVRARFETMIRAAQDSVCDAIEAIEG-GPKFKEDVWSRPGGGGGISRVLQ 127

  Fly   134 DGDVFEKAGVNISVVTGSLPPAAVQQMRARGKNLKEGASLPFFASGVSAVIHPRNPHVPTIHFNY 198
            ||:||||||||:|||.|.:||.|.:..:....:.|.| .:||||:|||:|:||:||..||:||||
plant   128 DGNVFEKAGVNVSVVYGVMPPEAYRAAKGSASDQKPG-PVPFFAAGVSSVLHPKNPFAPTLHFNY 191

  Fly   199 RYFEVETAK----GEKQWWFGGGTDLTPYYLCEKDASHFHQTLKSACDEHDPTYYPRFKKWCDDY 259
            ||||.:..|    ..:|||||||||.||.|:.|:|..|||...|.|||:.||::|||||||||||
plant   192 RYFETDAPKDVPGAPRQWWFGGGTDFTPAYIFEEDVKHFHSIQKQACDKFDPSFYPRFKKWCDDY 256

  Fly   260 FRIKHRNESRGIGGIFFDDIDSPNQEAAFNFVSSCARAVIPSYVPLVRKHKNREYGNNERQWQLL 324
            |.||||:|.||:|||||||::..:||...:|.:.||.:|:|:|:|:|.|.|:.|:....:.||.|
plant   257 FYIKHRDERRGLGGIFFDDLNDYDQEMLLSFATECANSVVPAYIPIVEKRKDMEFTEQHKAWQQL 321

  Fly   325 RRGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLHARWEYMHEPKSQSEEGKLMKVLKNPKDW 389
            ||||||||||:|||||.|||.| |.|.||||:||||.|||||.|:|:..:||.||:....|||:|
plant   322 RRGRYVEFNLVYDRGTTFGLKT-GGRIESILVSLPLSARWEYDHKPEEGTEEWKLLDACINPKEW 385

  Fly   390 V 390
            :
plant   386 I 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoproxNP_001285697.1 Coprogen_oxidas 88..390 CDD:279549 175/305 (57%)
LIN2NP_171847.4 PLN02873 116..386 CDD:215471 159/271 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 372 1.000 Domainoid score I174
eggNOG 1 0.900 - - E1_COG0408
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76
Inparanoid 1 1.050 378 1.000 Inparanoid score I539
OMA 1 1.010 - - QHG63158
OrthoDB 1 1.010 - - D1080991at2759
OrthoFinder 1 1.000 - - FOG0003913
OrthoInspector 1 1.000 - - otm3060
orthoMCL 1 0.900 - - OOG6_101984
Panther 1 1.100 - - LDO PTHR10755
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2692
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.