DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coprox and CPOX

DIOPT Version :9

Sequence 1:NP_001285697.1 Gene:Coprox / 44701 FlyBaseID:FBgn0021944 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_000088.3 Gene:CPOX / 1371 HGNCID:2321 Length:454 Species:Homo sapiens


Alignment Length:400 Identity:233/400 - (58%)
Similarity:284/400 - (71%) Gaps:24/400 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTFQLVRRTRGPHARGF-LLGTGL-----GLASFSAVTYAHSAEA-VDPKVNGVQMNT------- 64
            ||.|......|..:||. .:||||     ||...:...:.|...| :.||.:|.:..:       
Human    55 GTEQSRGLGHGSTSRGGPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEE 119

  Fly    65 --------SRFMAEPITDSKALLGDKENMRHRMEILIMEIQAEFCRALEAEENCGQKFKVDRWER 121
                    |.|||.|:||...|.....:|:.:||:||:|.||:.|:|| |:.:.|..|.||||||
Human   120 EDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQAL-AQVDGGANFSVDRWER 183

  Fly   122 PEGGGGITCVLQDGDVFEKAGVNISVVTGSLPPAAVQQMRARGKNLK-EGASLPFFASGVSAVIH 185
            .||||||:||||||.|||||||:||||.|:|...|.:|||:|||.|| :...|||.|.|||:|||
Human   184 KEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIH 248

  Fly   186 PRNPHVPTIHFNYRYFEVETAKGEKQWWFGGGTDLTPYYLCEKDASHFHQTLKSACDEHDPTYYP 250
            |:|||.|||||||||||||.|.|.||||||||.||||.||.::||.|||:|||.|||:|.|..||
Human   249 PKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTLKEACDQHGPDLYP 313

  Fly   251 RFKKWCDDYFRIKHRNESRGIGGIFFDDIDSPNQEAAFNFVSSCARAVIPSYVPLVRKHKNREYG 315
            :|||||||||.|.||.|.||||||||||:|||::|..|.||.||||||:|||:|||:||.:..:.
Human   314 KFKKWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEVFRFVQSCARAVVPSYIPLVKKHCDDSFT 378

  Fly   316 NNERQWQLLRRGRYVEFNLIYDRGTKFGLYTPGARYESILMSLPLHARWEYMHEPKSQSEEGKLM 380
            ..|:.||.|||||||||||:|||||||||:|||:|.|||||||||.|||||||.|...|:|.:::
Human   379 PQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENSKEAEIL 443

  Fly   381 KVLKNPKDWV 390
            :||::|:|||
Human   444 EVLRHPRDWV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoproxNP_001285697.1 Coprogen_oxidas 88..390 CDD:279549 205/302 (68%)
CPOXNP_000088.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..70 4/14 (29%)
Coprogen_oxidas 151..453 CDD:307396 205/302 (68%)
Important for dimerization. /evidence=ECO:0000305 193..202 7/8 (88%)
Substrate binding 260..262 1/1 (100%)
Important for dimerization 392..428 30/35 (86%)
Substrate binding 411..413 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141023
Domainoid 1 1.000 445 1.000 Domainoid score I531
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76
Inparanoid 1 1.050 461 1.000 Inparanoid score I1567
Isobase 1 0.950 - 0 Normalized mean entropy S987
OMA 1 1.010 - - QHG63158
OrthoDB 1 1.010 - - D1080991at2759
OrthoFinder 1 1.000 - - FOG0003913
OrthoInspector 1 1.000 - - oto90506
orthoMCL 1 0.900 - - OOG6_101984
Panther 1 1.100 - - LDO PTHR10755
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R557
SonicParanoid 1 1.000 - - X2692
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.