DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and UIP5

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_012970.3 Gene:UIP5 / 853918 SGDID:S000001752 Length:443 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:73/331 - (22%)
Similarity:127/331 - (38%) Gaps:67/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGNLSPGAVGVHRRFEYKYSFKPPYLAQKDGTVPFWEYGG-NAIASSESVRVAPSLRSQK-GAIW 83
            |...:.|...|.|...:..|...|:|   |....||..|| ..|.:.:|:::.......| |.:.
Yeast    41 TSPFTRGRSHVTRVPNHDASLSIPFL---DKINQFWHVGGATQIRNIQSIKLTQDRDQDKHGLVL 102

  Fly    84 TKSQTNFDWWDVEIVF----------RVTGRGRIGADGLAFWYTTEKG-------------DY-- 123
            :....:....|.||||          ::||      ||:.|..|.|.|             .|  
Yeast   103 SNGIGDNTINDFEIVFTFRISHDPTTQLTG------DGMCFAITPENGFLTQNLQSSYAKKQYMM 161

  Fly   124 --------NGPVFGSSDRWNGLAIMFDSFDNDNKHNN---PYISAVLN--DGTKLYDHAEDG--T 173
                    |..:.|......||.|:.|::.|.. |::   |::...:|  ..:..||...||  :
Yeast   162 NSQGVIADNTDLMGFPKNLPGLFIVLDTYRNQG-HDHKEVPFMDVFINVAPESDWYDINSDGELS 225

  Fly   174 TQL---LSGCLRDFRNKPF--PTRARIEYYNNVLTVMIHNGMSNNNDDY-ELCLRADGVNLPKN- 231
            |.|   ..|.::..:|..:  .|:.||.|..::..:.|....:...:.: ||....:.:.|||| 
Yeast   226 TSLRLNSRGHIKLKKNALWNRVTKLRIIYLESISFLKIDVQYAKEGNYWIELFQTTENLYLPKNM 290

  Fly   232 ----GYFGISAATGGLADDHDVFHFLTTSLH---AAGQVQEQPKVENQEKLTQEYKEYQDKLEKQ 289
                .|.|.||..|.|.:..::....|:..|   ....:::......:.:|..| :|:.:.|:::
Yeast   291 HTGQRYIGCSALNGQLTETVELLDVSTSEFHWNDMDASIEDTYDYAKEAELFLE-QEFGEVLDRE 354

  Fly   290 KQEYKK 295
            ..|:.|
Yeast   355 PDEFTK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 63/277 (23%)
UIP5NP_012970.3 lectin_leg-like 55..320 CDD:173892 62/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12223
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.