DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and EMP46

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_013181.1 Gene:EMP46 / 850769 SGDID:S000004070 Length:444 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:72/332 - (21%)
Similarity:133/332 - (40%) Gaps:65/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GNAIASSESVRVAPSLRSQKGAIWTKSQTNF-DWWDVEIVFRVTGRGRIGADGLAFWYTT-EKGD 122
            |:.:...|...|....::.||::|.|.:.:. |...:|..||..|.......|||||... .:||
Yeast    81 GDKVKLEEGRFVLTPGKNTKGSLWLKPEYSIKDAMTIEWTFRSFGFRGSTKGGLAFWLKQGNEGD 145

  Fly   123 YNGPVFGSSDRWNGLAIMFDSFDNDNKHNNPYISAVLNDGTKLYDHAEDGTTQLLSGCLRDFRNK 187
            ......|||.::|||.|:....|...:.    ::|.||||||..|..   ::...:.||..:::.
Yeast   146 STELFGGSSKKFNGLMILLRLDDKLGES----VTAYLNDGTKDLDIE---SSPYFASCLFQYQDS 203

  Fly   188 PFPTRARIEYY---NNVLTVMIHNGMSNNNDDYELCLRADGVNLPKNGYF--GISAATGGLADDH 247
            ..|:..|:.|.   |::|.:.:.|         .:|.:...|....:..|  |.||......:..
Yeast   204 MVPSTLRLTYNPLDNHLLKLQMDN---------RVCFQTRKVKFMGSSPFRIGTSAINDASKESF 259

  Fly   248 DVFHF----------LTTSLHAAGQVQEQPKVENQEKLTQEYKE---YQDKLEKQKQEYKKDHPD 299
            ::...          |..:::..||.:...||.|.:...:.::|   :.||.|....        
Yeast   260 EILKMKLYDGVIEDSLIPNVNPMGQPRVVTKVINSQTGEESFREKMPFSDKEESITS-------- 316

  Fly   300 EHKDEEDWEEFYESENQRE-------LRQIWQGQSQIADHLRELSRKVDEIIGRQETTLS----- 352
                    .|.:|..|:.|       :..:.:..::|.::.|||.:::..::..::|.:|     
Yeast   317 --------NELFEKMNKLEGKIMANDIDPLLRKMNKIVENERELIQRLRPLLDLKKTAISDDSFQ 373

  Fly   353 -LVSRNA 358
             .:|.||
Yeast   374 DFLSMNA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 50/214 (23%)
EMP46NP_013181.1 lectin_EMP46_EMP47 56..270 CDD:173891 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345764
Domainoid 1 1.000 50 1.000 Domainoid score I2896
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I1818
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100344
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12223
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5289
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.