DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and AT1G70110

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_177168.1 Gene:AT1G70110 / 843347 AraportID:AT1G70110 Length:666 Species:Arabidopsis thaliana


Alignment Length:233 Identity:49/233 - (21%)
Similarity:75/233 - (32%) Gaps:65/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GGNAIASSESVRVAPSLRSQKGAIWTKSQTNF--------DWWDVEIVFRVT-GRGRIGADGLAF 114
            |...|.::..:|:..|.....|.::...|..|        ..:....||.:. ..|..|..|:||
plant    38 GSAYINNNGLIRLTNSTPQTTGQVFYNDQLRFKNSVNGTVSSFSTTFVFSIEFHNGIYGGYGIAF 102

  Fly   115 -----------WYTTEKGDYNGPVFGSSDRWNGL-AIMFDS------FDNDNKHNNPYISAVLND 161
                       :.||..|.:|....|  |..|.: |:..|:      .|.|..|....|:.:::|
plant   103 VICPTRDLSPTFPTTYLGLFNRSNMG--DPKNHIVAVELDTKVDQQFEDKDANHVGIDINTLVSD 165

  Fly   162 GTKLYDHAEDGTTQLLSGCLRDFR----NKPFPTRARIEY--YNNVLTVMIHN-----------G 209
            ...|..:..|..|         ||    |...|.:..|||  ....:.|.:|.           .
plant   166 TVALAGYYMDNGT---------FRSLLLNSGQPMQIWIEYDSKQKQINVTLHPLYVPKPKIPLLS 221

  Fly   210 MSNNNDDYELCLRADGVNLPKNGYFGISAATGGLADDH 247
            :..:...|.|.|.          |.|.::.||.|...|
plant   222 LEKDLSPYLLELM----------YVGFTSTTGDLTASH 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 49/233 (21%)
AT1G70110NP_177168.1 lectin_legume_LecRK_Arcelin_ConA 26..260 CDD:173887 49/233 (21%)
STKc_IRAK 350..615 CDD:270968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.