DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and AT5G06740

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001330436.1 Gene:AT5G06740 / 830563 AraportID:AT5G06740 Length:664 Species:Arabidopsis thaliana


Alignment Length:502 Identity:100/502 - (19%)
Similarity:165/502 - (32%) Gaps:193/502 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GNAIASSESVRVAPSLRSQKGAIWTKSQTNFDWWDVEIVFRVTGRGRIGADGLAFWYTTEKGDYN 124
            |..||:    :...:|..:...:|:|.::  ..::...|..::.:...|.:||||..|.|:   .
plant    75 GGTIAN----QAGRALYKKPFRLWSKHKS--ATFNTTFVINISNKTDPGGEGLAFVLTPEE---T 130

  Fly   125 GPVFGSSDRWNGLAIMFDSFDNDNKHNNPYISAVLNDGTKLYDHAEDG-------------TTQL 176
            .|. .||..|.|:.     .:..|::|...|.:|..|..|.:....||             ..:.
plant   131 APQ-NSSGMWLGMV-----NERTNRNNESRIVSVEFDTRKSHSDDLDGNHVALNVNNINSVVQES 189

  Fly   177 LSGCLRDFR-NKPFPTRARIEYYNNVLTVMIHNGMSNNNDDYE----LCLRADGVN--LPKNGYF 234
            |||  |..: :......|.:.|....|:|.:    |.|.|.:|    :..||..::  ||:..|.
plant   190 LSG--RGIKIDSGLDLTAHVRYDGKNLSVYV----SRNLDVFEQRNLVFSRAIDLSAYLPETVYV 248

  Fly   235 GISAATG--------------GLADDHD------------VF-----HFL----TTSLHAAGQVQ 264
            |.:|:|.              ||..|.|            ||     .||    ..|...||:. 
plant   249 GFTASTSNFTELNCVRSWSFEGLKIDGDGNMLWLWITIPIVFIVGIGAFLGALYLRSRSKAGET- 312

  Fly   265 EQPKVENQEKLTQEYKEYQDKLEKQKQEYKKDHPDEHKDEEDWEEFYESENQRELRQI------- 322
             .|.:|.:          .|......|::|                     .|||::.       
plant   313 -NPDIEAE----------LDNCAANPQKFK---------------------LRELKRATGNFGAE 345

  Fly   323 ---------------WQGQSQIADHLRELSRKVDEIIGRQE-----TTL-SLVSRNAGQALPPPA 366
                           |||:......:.|.|.:     |:||     ||: :|..||..:.|    
plant   346 NKLGQGGFGMVFKGKWQGRDIAVKRVSEKSHQ-----GKQEFIAEITTIGNLNHRNLVKLL---- 401

  Fly   367 AGG---------VPQQQLPVGAV---------SRSDVDL-----LLTNQNMLLSSI--------- 399
              |         :..:.:|.|::         |||::..     ::|..:..|..:         
plant   402 --GWCYERKEYLLVYEYMPNGSLDKYLFLEDKSRSNLTWETRKNIITGLSQALEYLHNGCEKRIL 464

  Fly   400 -REIR----QLVGDINVRTDNI-------QTNQKHAPTAQIQST-GY 433
             |:|:    .|..|.|.:..:.       |:...|..|.:|..| ||
plant   465 HRDIKASNVMLDSDFNAKLGDFGLARMIQQSEMTHHSTKEIAGTPGY 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 56/252 (22%)
AT5G06740NP_001330436.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.