DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and AT4G29050

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001328105.1 Gene:AT4G29050 / 829026 AraportID:AT4G29050 Length:683 Species:Arabidopsis thaliana


Alignment Length:304 Identity:66/304 - (21%)
Similarity:108/304 - (35%) Gaps:96/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FKPPYLAQ-KDGTVPF----WEYGGNAIASSES-VRVAPSLRSQKGAIWTKSQTNF--------D 91
            |....|:| ::|...|    ::..|.||.:|:. :::..|.....|.::..|...|        .
plant    29 FSNKALSQSEEGEFGFNGYLYDNSGIAITNSKGLMKLTNSSEFSYGHVFYNSPVRFKNSPNGTVS 93

  Fly    92 WWDVEIVFRVTGR-GRIGADGLAFWYTTEKGDYNGPVFGSSDRWNGL--------------AIMF 141
            .:....||.:... ..:...||||..:..|    |..:.||.::.||              |:.|
plant    94 SFSTTFVFAIVSNVNALDGHGLAFVISPTK----GLPYSSSSQYLGLFNLTNNGDPSNHIVAVEF 154

  Fly   142 DSFDN------DNKHNNPYISAVLND--GTKLYDHAEDGTTQLLSGCLRDFRN----KPFPTRAR 194
            |:|.|      ||.|....|:::.::  .|..|...:|||          |:|    ...|.:|.
plant   155 DTFQNQEFDDMDNNHVGIDINSLSSEKASTAGYYEDDDGT----------FKNIRLINQKPIQAW 209

  Fly   195 IEYYNN--VLTVMIHNGMSNNNDDYELCLRADGVNLPK------------------NGYFGISAA 239
            |||.::  .|.|.||                 .::|||                  :.|.|.::|
plant   210 IEYDSSRRQLNVTIH-----------------PIHLPKPKIPLLSLTKDLSPYLFDSMYVGFTSA 257

  Fly   240 TGGLADDHDVFHFLTTSLHAAG---QVQEQPKVENQEKLTQEYK 280
            ||.|...|.:..: |..|:...   .:...||:....:.|...|
plant   258 TGRLRSSHYILGW-TFKLNGTASNIDISRLPKLPRDSRSTSVKK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 61/277 (22%)
AT4G29050NP_001328105.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.