DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and AT3G59730

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_191532.1 Gene:AT3G59730 / 825142 AraportID:AT3G59730 Length:523 Species:Arabidopsis thaliana


Alignment Length:153 Identity:34/153 - (22%)
Similarity:52/153 - (33%) Gaps:62/153 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 NKHNNPYI---SAVLNDGTKL---------YDHAEDGTTQLLSGCLRDFRNKPF----------- 189
            |.|.. ||   |||.|:.:.|         |..|.|.||       .:.:::.|           
plant    24 NSHGT-YILDGSAVFNENSYLVLTNTTKHSYGQAFDNTT-------FEMKDQSFSINFFFAIVPE 80

  Fly   190 --------------PTR----ARIEYYNNVLTVMIHNGMSNNNDDYELCLRAD-----------G 225
                          |||    |..:.|..:.....:...||:....||.:..|           |
plant    81 HKQQGSHGMTFAFSPTRGLPGASSDQYLGLFNKTNNGKTSNHVIAIELDIHKDEEFEDIDDNHVG 145

  Fly   226 VNLPKNGYFGISAATGGLADDHD 248
            :|:  ||...:::|:.|..||:|
plant   146 INI--NGLRSVASASAGYYDDND 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 34/153 (22%)
AT3G59730NP_191532.1 lectin_legume_LecRK_Arcelin_ConA 19..241 CDD:173887 34/153 (22%)
S_TKc 335..>510 CDD:214567
PKc_like 341..>517 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.